PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Do022031.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Dichantheliinae; Dichanthelium
Family Dof
Protein Properties Length: 212aa    MW: 22179.4 Da    PI: 7.3707
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Do022031.1genomeDichanView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.69.9e-3749105258
      zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                 ++++l+cprC+stntkfCyynnys++qPr+fC+aCrryWt+GG+lr+vPvGg++r++
  Do022031.1  49 PKQQLECPRCQSTNTKFCYYNNYSTAQPRHFCRACRRYWTHGGTLRDVPVGGASRRS 105
                 7899***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027015.7E-3351105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.83853107IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-205397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MAPAAAAASI LSATSAAASK RPAASDADHL DGSSVLHQGD DAARKGQQPK QQLECPRCQS  60
TNTKFCYYNN YSTAQPRHFC RACRRYWTHG GTLRDVPVGG ASRRSGSGAK RRRVSADPSS  120
SSASSPPQTA ARAEFDACLP DLSAFPFLSD GSFLPQFDLG VAPAAFSSWP SVVPDFYDGL  180
APWDDGTVGA TGVTGAWGDI AGLDLSWPPP GN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109113KRRRV
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00593DAPTransfer from AT5G66940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC5824142e-89KC582414.1 Sorghum bicolor dof21 protein (dof21) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960063.14e-88PREDICTED: dof zinc finger protein PBF-like
TrEMBLA0A0A9K5581e-105A0A0A9K558_ARUDO; Uncharacterized protein
STRINGSi023256m1e-87(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140472427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.17e-27Dof family protein